PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0428
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 359aa    MW: 39783.4 Da    PI: 6.9119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0428genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
      Gh_D04G0428 14 KGPWTPEEDQKLLAYIEEHGRGSWRSLPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding537.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
      Gh_D04G0428  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.378961IPR017930Myb domain
SuperFamilySSF466892.66E-3011108IPR009057Homeodomain-like
SMARTSM007173.5E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001671.28E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1667112IPR001005SANT/Myb domain
CDDcd001671.15E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGRGSWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPITHKPKN DALLSTTDGQ SKKAANLSHM AQWESARLEA EARLVRESKI RSHSLQHHHH  180
FNPPAFTLES PTSTLSVSEN APPIITGLGV SPMPMIEFVG TTSGSSETAG IVKEEGEQEW  240
KELGSSSNLA DYKEGMGNSL SSFTSSLQDM TISIEGGWTP ESLRPNNINV NNVGNIMEEG  300
FTNLLLNDSV NRSLSDSGKE SDENSGGSGD GSDYYQDNKN YWNSILNLVN SSPSDSPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.24590.0ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO783343500.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460422.10.0PREDICTED: myb-related protein Hv1
TrEMBLA0A0D2V2450.0A0A0D2V245_G
STRINGPOPTR_0017s12230.11e-180(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-127myb domain protein 16